PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 307aa    MW: 32758.3 Da    PI: 7.4718
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10618.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.11.8e-121155345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                      W++e d+ + +a + ++ +   +W++Ia+ ++ g+tl+++k+++ 
       KHN10618.1 11 EWSKEQDKAFENALAIHPEDasdRWEKIAADVP-GKTLEEIKHHYE 55
                     7********************************.**********96 PP

2Myb_DNA-binding43.76.2e-14133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
       KHN10618.1 133 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 177
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.573762IPR017884SANT domain
SMARTSM007172.2E-10860IPR001005SANT/Myb domain
SuperFamilySSF466892.48E-111066IPR009057Homeodomain-like
CDDcd001673.15E-101158No hitNo description
PfamPF002491.1E-91155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-51155IPR009057Homeodomain-like
PROSITE profilePS5129417.61125182IPR017930Myb domain
SuperFamilySSF466898.28E-17128183IPR009057Homeodomain-like
SMARTSM007174.5E-11130180IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.6E-17130180IPR006447Myb domain, plants
CDDcd001671.44E-10133178No hitNo description
PfamPF002497.8E-12133177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-11133176IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MTVDEVGSSS EWSKEQDKAF ENALAIHPED ASDRWEKIAA DVPGKTLEEI KHHYELLVED  60
VNQIESGCVP LPSYNSSPEG STSHASDEGA GKKGGHSWNS NNESNHGTKA SRSESNHGTK  120
ASRSDQERRK GIAWTEDEHR LFLLGLEKYG KGDWRSISRN FVVTRTPTQV ASHAQKYFIR  180
LNSMNKDRRR SSIHDITSVN NGDVSALQGP ITGQTNGSAA NCAGKSTKPP PPTPTAAPGV  240
GIYAAPTIGQ PIGGPLVSAV GTPVMNLPPP AHIAYGLGAP VPRAVVPGAP MNLGPVPYPM  300
SHTSAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-20777676RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0966930.0BT096693.1 Soybean clone JCVI-FLGm-25B10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003532025.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_006585964.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_014634810.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-63DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2PS800.0A0A0B2PS80_GLYSO; Transcription factor MYB1R1
STRINGGLYMA08G40020.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-115MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]